Oracle FAQ | Your Portal to the Oracle Knowledge Grid |
![]() |
![]() |
Home -> Community -> Usenet -> c.d.o.misc -> SQL Loader question
Hi, There, need your help urgently. Below is a gene's sequence(one record).
My question is: can I use the SQL Loader to select the text after ACCESSION
(in this one, it is 'M73473') and text after ORIGIN (multi-line) as two
field into my oracle table? I have tried to write a control file to load
into database, but it failed. Any suggestion?
Thanks,
LOCUS EKEGAG 177 bp DNA VRL 11-APR-1996
DEFINITION HIV-1 individual EKE from Congo, gag gene, p6 region.
ACCESSION M73473
NID g327340
KEYWORDS gag protein.
SOURCE Human immunodeficiency virus type 1 DNA.
ORGANISM Human immunodeficiency virus type 1
Viridae; ss-RNA enveloped viruses; Positive strand RNA virus; Retroviridae; Lentivirinae.REFERENCE 1 (bases 1 to 177)
J.M., Agut, H. TITLE High variability of the gag/pol transframe region among HIV-1isolates
Gentilini, M., M'Pele, P., Huraux, J.M., Agut, H. TITLE Genetic variability affects the detection of HIV by polymerase chain reaction.
COMMENT While this gag p6 region sequence clustered with subtype G in phylogenetic analysis, the env V3 region from the same patient clustered with subtype E (accession AF082313). This could be the first EG recombinant identified to date (July 1999) or it could be from a dual infection. A third possibility is that it represents a non-recombinant genome, similar to that from which the AE(CM240) circulating recombinant form is postulated to have arrisen. More data and complete genome sequencing would be required to help identify which caseapplies.
In phylogenetic analysis at the HIV-DB, EKE-gag-p6 clusters with the AGI-recombinant Z321 (accession U76035), and the EKE-env-V3 branched off the CRF AE(CM240) clade slightly closer to the M-group root than isolates from the Central African Repulic do. FEATURES Location/Qualifiers source 1..177// Received on Fri Oct 01 1999 - 13:39:22 CDT
/organism="Human immunodeficiency virus type 1"
/proviral
CDS 1..177
/partial
/gene="gag"
/codon_start=1
/db_xref="PID:g327341"
/translation="NFLGKIWPSNKGRPGNFLQNRPEPTAPPAESFETKEEITSSQKQ DPRDKELYPLTSLRS" BASE COUNT 55 a 45 c 43 g 34 t ORIGIN 1 aattttttag ggaaaatttg gccttccaac aaggggaggc cagggaattt tcttcagaac 61 aggccagagc caacagcccc acccgcagag agcttcgaga cgaaggagga gataacctcc 121 tctcagaagc aggatccgag ggacaaggaa ttatatccct taacttccct cagatca
![]() |
![]() |