Hi, There, need your help urgently. Below is a gene's sequence(one record).
My question is: can I use the SQL Loader to select the text after ACCESSION
(in this one, it is 'M73473') and text after ORIGIN (multi-line) as two
field into my oracle table? I have tried to write a control file to load
into database, but it failed. Any suggestion?
Thanks,
LOCUS EKEGAG 177 bp DNA VRL 11-APR-1996
DEFINITION HIV-1 individual EKE from Congo, gag gene, p6 region.
ACCESSION M73473
NID g327340
KEYWORDS gag protein.
SOURCE Human immunodeficiency virus type 1 DNA.
ORGANISM Human immunodeficiency virus type 1
Viridae; ss-RNA enveloped viruses; Positive strand RNA virus;
Retroviridae; Lentivirinae.
REFERENCE 1 (bases 1 to 177)
AUTHORS Candotti, D., Chappey, C., Rosenheim, M., M'Pele, P., Huraux,
J.M., Agut, H.
TITLE High variability of the gag/pol transframe region among HIV-1
isolates
JOURNAL C. R. Acad. Sci. III, Sci. Vie 317 (2), 183-189 (1994)
MEDLINE 95086896.
REFERENCE 2 (bases 1 to 177)
AUTHORS Candotti, D., Jung, M., Kerouedan, D., Rosenheim, M.,
Gentilini, M., M'Pele, P., Huraux, J.M., Agut, H.
TITLE Genetic variability affects the detection of HIV by polymerase
chain
reaction.
JOURNAL AIDS (8): 1003-1007 (1991)
MEDLINE 92134646.
COMMENT While this gag p6 region sequence clustered with subtype G in
phylogenetic analysis, the env V3 region from the same patient
clustered with subtype E (accession AF082313). This could be
the first EG recombinant identified to date (July 1999) or
it could be from a dual infection. A third possibility is
that it represents a non-recombinant genome, similar to that
from which the AE(CM240) circulating recombinant form is
postulated to have arrisen. More data and complete genome
sequencing would be required to help identify which case
applies.
In phylogenetic analysis at the HIV-DB, EKE-gag-p6 clusters
with the AGI-recombinant Z321 (accession U76035), and the
EKE-env-V3 branched off the CRF AE(CM240) clade slightly
closer to the M-group root than isolates from the Central
African Repulic do.
FEATURES Location/Qualifiers
source 1..177
/organism="Human immunodeficiency virus type 1"
/proviral
CDS 1..177
/partial
/gene="gag"
/codon_start=1
/db_xref="PID:g327341"
/translation="NFLGKIWPSNKGRPGNFLQNRPEPTAPPAESFETKEEITSSQKQ
DPRDKELYPLTSLRS"
BASE COUNT 55 a 45 c 43 g 34 t
ORIGIN
1 aattttttag ggaaaatttg gccttccaac aaggggaggc cagggaattt tcttcagaac
61 aggccagagc caacagcccc acccgcagag agcttcgaga cgaaggagga gataacctcc
121 tctcagaagc aggatccgag ggacaaggaa ttatatccct taacttccct cagatca
//
Received on Fri Oct 01 1999 - 13:39:22 CDT
